RPC10_HUMAN Q9Y2Y1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Y2Y1
Recommended name：DNA-directed RNA polymerase III subunit RPC10
EC number：
Alternative names：(RNA polymerase III subunit C10) (DNA-directed RNA polymerase III subunit K) (RNA polymerase III 12.5 kDa subunit) (RPC12.5) (RNA polymerase III subunit C11) (HsC11p) (RPC11) (hRPC11)
Cleaved into：
GeneID：51728
Gene names (primary )：POLR3K
Gene names (synonym )：RPC11
Gene names (ORF )：My010
Length：108
Mass：12336
Sequence：MLLFCPGCGNGLIVEEGQRCHRFSCNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
Tissue specificity：
Induction：
Developmental stage：
Protein families：Archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family