PEX7_HUMAN   O00628


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O00628

Recommended name:Peroxisomal targeting signal 2 receptor

EC number:

Alternative names:(PTS2 receptor) (Peroxin-7)

Cleaved into:

GeneID:5191

Gene names  (primary ):PEX7

Gene names  (synonym ):PTS2R

Gene names  (ORF ):

Length:323

Mass:35892

Sequence:MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLILDPDEAGLRLFRSFDWNDGLFDVTWSENNEHVLITCSGDGSLQLWDTAKAAGPLQVYKEHAQEVYSVDWSQTRGEQLVVSGSWDQTVKLWDPTVGKSLCTFRGHESIIYSTIWSPHIPGCFASASGDQTLRIWDVKAAGVRIVIPAHQAEILSCDWCKYNENLLVTGAVDCSLRGWDLRNVRQPVFELLGHTYAIRRVKFSPFHASVLASCSYDFTVRFWNFSKPDSLLETVEHHTEFTCGLDFSLQSPTQVADCSWDETIKIYDPACLTIPA

Tissue specificity:Ubiquitous. Highest expression in pancreas, skeletal muscle and heart.

Induction:

Developmental stage:

Protein families:WD repeat peroxin-7 family


   💬 WhatsApp