MIC13_HUMAN   Q5XKP0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5XKP0

Recommended name:MICOS complex subunit MIC13

EC number:

Alternative names:(Protein P117)

Cleaved into:

GeneID:125988

Gene names  (primary ):MICOS13

Gene names  (synonym ):C19orf70 MIC13 QIL1

Gene names  (ORF ):

Length:118

Mass:13087

Sequence:MVARVWSLMRFLIKGSVAGGAVYLVYDQELLGPSDKSQAALQKAGEVVPPAMYQFSQYVCQQTGLQIPQLPAPPKIYFPIRDSWNAGIMTVMSALSVAPSKAREYSKEGWEYVKARTK

Tissue specificity:

Induction:

Developmental stage:

Protein families:MICOS complex subunit Mic13 family


   💬 WhatsApp