LRC51_HUMAN   Q96E66


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96E66

Recommended name:Leucine-rich repeat-containing protein 51

EC number:

Alternative names:(Protein LRTOMT1)

Cleaved into:

GeneID:120356739

Gene names  (primary ):LRTOMT

Gene names  (synonym ):LRRC51

Gene names  (ORF ):

Length:192

Mass:22206

Sequence:MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPVLTTFFNLSVLYLHGNSIQRLGEVNKLAVLPRLRSLTLHGNPMEEEKGYRQYVLCTLSRITTFDFSGVTKADRTTAEVWKRMNIKPKKAWTKQNTL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp