SIM29_HUMAN   Q86T20


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q86T20

Recommended name:Small integral membrane protein 29

EC number:

Alternative names:(Protein LBH)

Cleaved into:

GeneID:221491

Gene names  (primary ):SMIM29

Gene names  (synonym ):C6orf1 LBH

Gene names  (ORF ):

Length:102

Mass:11550

Sequence:MSNTTVPNAPQANSDSMVGYVLGPFFLITLVGVVVAVVMYVQKKKRVDRLRHHLLPMYSYDPAEELHEAEQELLSDMGDPKVVHGWQSGYQHKRMPLLDVKT

Tissue specificity:Expressed in spleen, thymus, prostate, testis, uterus, small intestine, colon and peripheral blood leukocytes. {ECO:0000269|PubMed:10036196}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp