PPIE_HUMAN   Q9UNP9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UNP9

Recommended name:Peptidyl-prolyl cis-trans isomerase E

EC number:EC:5.2.1.8

Alternative names:(PPIase E) (Cyclophilin E) (Cyclophilin-33) (Rotamase E)

Cleaved into:

GeneID:10450

Gene names  (primary ):PPIE

Gene names  (synonym ):CYP33

Gene names  (ORF ):

Length:301

Mass:33431

Sequence:MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV

Tissue specificity:Found in all the examined tissues including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.

Induction:

Developmental stage:

Protein families:Cyclophilin-type PPIase family, PPIase E subfamily


   💬 WhatsApp