TCP4_HUMAN   P53999


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P53999

Recommended name:Activated RNA polymerase II transcriptional coactivator p15

EC number:

Alternative names:(Positive cofactor 4) (PC4) (SUB1 homolog) (p14)

Cleaved into:

GeneID:10923

Gene names  (primary ):SUB1

Gene names  (synonym ):PC4 RPO2TC1

Gene names  (ORF ):

Length:127

Mass:14395

Sequence:MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL

Tissue specificity:

Induction:

Developmental stage:

Protein families:Transcriptional coactivator PC4 family


   💬 WhatsApp