POPD3_HUMAN   Q9HBV1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9HBV1

Recommended name:Popeye domain-containing protein 3

EC number:

Alternative names:(Popeye protein 3)

Cleaved into:

GeneID:64208

Gene names  (primary ):POPDC3

Gene names  (synonym ):POP3

Gene names  (ORF ):

Length:291

Mass:33870

Sequence:MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLGFLCSAVWAWVDVCAADIFSWNFVLFVICFMQFVHIAYQVRSITFAREFQVLYSSLFQPLGISLPVFRTIALSSEVVTLEKEHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPLQFLDSPEWDSLRPTEEGIFQVTLTAETDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQMSTPEIRRSPLTQHFQNSRRYCDK

Tissue specificity:Expressed predominantly in skeletal muscle and detected in heart. {ECO:0000269|PubMed:10882522}.

Induction:

Developmental stage:

Protein families:Popeye family


   💬 WhatsApp