POZP3_HUMAN   Q6PJE2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6PJE2

Recommended name:POM121 and ZP3 fusion protein

EC number:

Alternative names:(POM-ZP3)

Cleaved into:

GeneID:22932

Gene names  (primary ):POMZP3

Gene names  (synonym ):

Gene names  (ORF ):

Length:187

Mass:20620

Sequence:MVCSPVTLRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKKKKRTVEEEDQIFLDGQENKRSCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEGLADICQCCNKGDCGTPSHSRRQPRVVSQWSTSASL

Tissue specificity:Expressed in spleen, thymus, pancreas, testis, ovary, small intestine, colon and lymphocytes. {ECO:0000269|PubMed:7789967}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp