REEP5_HUMAN   Q00765


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q00765

Recommended name:Receptor expression-enhancing protein 5

EC number:

Alternative names:(Polyposis locus protein 1) (Protein TB2)

Cleaved into:

GeneID:7905

Gene names  (primary ):REEP5

Gene names  (synonym ):C5orf18 DP1 TB2

Gene names  (ORF ):

Length:189

Mass:21493

Sequence:MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

Tissue specificity:Expressed in circumvallate papillae and testis. {ECO:0000269|PubMed:16720576}.

Induction:

Developmental stage:

Protein families:DP1 family


   💬 WhatsApp