IPKB_HUMAN   Q9C010


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9C010

Recommended name:cAMP-dependent protein kinase inhibitor beta

EC number:

Alternative names:(PKI-beta)

Cleaved into:

GeneID:5570

Gene names  (primary ):PKIB

Gene names  (synonym ):PRKACN2

Gene names  (ORF ):

Length:78

Mass:8468

Sequence:MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK

Tissue specificity:

Induction:

Developmental stage:

Protein families:PKI family


   💬 WhatsApp