PDZ1P_HUMAN   A8MUH7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A8MUH7

Recommended name:Putative PDZ domain-containing protein PDZK1P1

EC number:

Alternative names:(PDZ domain-containing 1 pseudogene 1) (PDZ domain-containing 1 pseudogene 2)

Cleaved into:

GeneID:

Gene names  (primary ):PDZK1P1

Gene names  (synonym ):PDZK1P2

Gene names  (ORF ):

Length:402

Mass:44056

Sequence:MNGGVQTWTQPRLCYLVKEGGSHGFSLKTVQGKKGVYMTDITPQGVAMRAGVLADDHLIEVNGENVEDASHEEVVEKVKKSGSRVMFLLVDKETDKRHVEQKIQFKRETASLKLLPHQPRIVEMKKGSNGYGFYLRAGSEQKGWGRVGQIIKDIDSGSPAEEAGLKNNDLVVAVNGESVETLDHDSVVEMIRKGGDQTSLLVVDKETDNMYRLAHFSPFLYYQSQELPNGSVKEAPAPTPTSLEVSSPPDTTEEEDHKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCGKKAYDYFQAKKIPIVSSLADPLDTPPDSKEGIVVESKHDSHMAKERAHSTASHSSSNSEDTEM

Tissue specificity:

Induction:

Developmental stage:

Protein families:NHER family


   💬 WhatsApp