REG1B_HUMAN   P48304


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P48304

Recommended name:Lithostathine-1-beta

EC number:

Alternative names:(Pancreatic stone protein 2) (PSP-2) (Regenerating islet-derived protein 1-beta) (REG-1-beta) (Regenerating protein I beta)

Cleaved into:

GeneID:5968

Gene names  (primary ):REG1B

Gene names  (synonym ):PSPS2 REGL

Gene names  (ORF ):

Length:166

Mass:18665

Sequence:MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDTGSPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp