BWR1B_HUMAN Q8N1D0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8N1D0
Recommended name：Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene B protein
EC number：
Alternative names：(Organic cation transporter-like protein 2 antisense protein) (Solute carrier family 22 member 1-like antisense protein) (Solute carrier family 22 member 18 antisense protein) (p27-Beckwith-Wiedemann region 1 B) (p27-BWR1B)
Cleaved into：
GeneID：5003
Gene names (primary )：SLC22A18AS
Gene names (synonym )：BWR1B BWSCR1B ORCTL2S SLC22A1LS
Gene names (ORF )：
Length：253
Mass：27061
Sequence：MGELPGSEGMWENCPLGWVKKKASGTLAPLDFLLQRKRLWLWASEPVRPQPQGIHRFREARRQFCRMRGSRLTGGRKGFGSSGLRFGRGGFSEEVMPQPVLKAMRCAEGAWWFSPDGPAGSAASIWPAEGAEGLPGQLGRDRLEVVYSVPDNVPGQNGSRRPLVCKITGKCLSVCSEENAKAGGCSAFPLLLSQLGARMTGREHAHKGPELTTPDSGLPRPPNPALAGFRALAQHSPPLGTSTPSAVLLSAAT
Tissue specificity：Most abundantly expressed in gastrointestinal tissues. Expressed at lower levels in kidney and placenta. Expressed in fetal brain, liver, placenta, kidney and lung. {ECO:0000269|PubMed:15175115, ECO:0000269|PubMed:9520460}.
Induction：
Developmental stage：
Protein families：