OR5H8_HUMAN   P0DN80


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0DN80

Recommended name:Olfactory receptor 5H8

EC number:

Alternative names:(Olfactory receptor 5H8 pseudogene) (Olfactory receptor OR3-7)

Cleaved into:

GeneID:

Gene names  (primary ):OR5H8

Gene names  (synonym ):OR5H8P

Gene names  (ORF ):

Length:308

Mass:34772

Sequence:MDDENATLLTEFVLTGLTYQSEWKIPLFLAFLVIYLITIMANLGLIAVIWKDSHLHIPMYLFLGSLAFVDAWLSSSVTPKMLISFLAKSMIISVSECKIQFFSFGISGTTECFLLATMAYDRYVAICKPLLYPVIMTNGLCIWLLVLSFIGGFLHALIHEGILFRLTFCNSNIIHHFYCDIIPLLKISCTDPSINFLMLFILSGSIQVFTILTVLVSYTFVLFTILKKKAKDIRKAFSTCGAHLLSVSLYYGPLLFMYVHPASPQADDQDMVESLFYTVIIPFLNPIIYSLRNKQVIDSLTKTLKGNV

Tissue specificity:

Induction:

Developmental stage:

Protein families:G-protein coupled receptor 1 family


   💬 WhatsApp