NKG2F_HUMAN   O43908


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O43908

Recommended name:NKG2-F type II integral membrane protein

EC number:

Alternative names:(NK cell receptor F) (NKG2-F-activating NK receptor)

Cleaved into:

GeneID:8302

Gene names  (primary ):KLRC4

Gene names  (synonym ):NKG2F

Gene names  (ORF ):

Length:158

Mass:18234

Sequence:MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL

Tissue specificity:Natural killer cells.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp