BCL8_HUMAN   P0C6P0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0C6P0

Recommended name:Putative protein BCL8

EC number:

Alternative names:(Neurobeachin pseudogene 1)

Cleaved into:

GeneID:

Gene names  (primary ):NBEAP1

Gene names  (synonym ):BCL8 BCL8A

Gene names  (ORF ):

Length:100

Mass:11233

Sequence:MSCCLSSRVHITRPVLEQFLSFAKYLDGLSHGVPLLKQLCDHILFINPAIWIHTPAKVQLSLYTYLSAEFIGTATIYTTICRIGTVIKDNAHLKILLLGY

Tissue specificity:Expressed in prostate and testis. {ECO:0000269|PubMed:12160729, ECO:0000269|PubMed:9159141}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp