GNAS3_HUMAN   O95467


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O95467

Recommended name:Neuroendocrine secretory protein 55

EC number:

Alternative names:(NESP55)

Cleaved into:LHAL tetrapeptide; GPIPIRRH peptide

GeneID:2778

Gene names  (primary ):GNAS

Gene names  (synonym ):GNAS1

Gene names  (ORF ):

Length:245

Mass:28029

Sequence:MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQRRSFLNAHHRSGAQVFPESPESESDHEHEEADLELSLPECLEYEEEFDYETESETESEIESETDFETEPETAPTTEPETEPEDDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPPSTQEPQSPREGEELKPEDKDPRDPEESKEPKEEKQRRRCKPKKPTRRDASPESPSKKGPIPIRRH

Tissue specificity:

Induction:

Developmental stage:

Protein families:NESP55 family


   💬 WhatsApp