RT12_HUMAN O15235
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O15235
Recommended name：28S ribosomal protein S12, mitochondrial
EC number：
Alternative names：(MRP-S12) (S12mt) (MT-RPS12) (Mitochondrial small ribosomal subunit protein uS12m)
Cleaved into：
GeneID：6183
Gene names (primary )：MRPS12
Gene names (synonym )：RPMS12 RPSM12
Gene names (ORF )：
Length：138
Mass：15173
Sequence：MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK
Tissue specificity：
Induction：
Developmental stage：
Protein families：Universal ribosomal protein uS12 family