MB3L1_HUMAN Q8WWY6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8WWY6
Recommended name:Methyl-CpG-binding domain protein 3-like 1
EC number:
Alternative names:(MBD3-like protein 1)
Cleaved into:
GeneID:85509
Gene names (primary ):MBD3L1
Gene names (synonym ):MBD3L
Gene names (ORF ):
Length:194
Mass:21616
Sequence:MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRRLQGLQAYSSAGELSSTLDLANTLQKLVPSYTGGSLLEDLASGLEHSCPMPHLACSSDAVEIIPAEGVGISQLLCKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANEAEKVRDQEGRPEKR
Tissue specificity:Highly expressed in testis. Detected at low levels in pancreas. Not detected in the other tissues tested. {ECO:0000269|PubMed:12504854}.
Induction:
Developmental stage:
Protein families:MBD3L family