MAP12_HUMAN   Q6UB28


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6UB28

Recommended name:Methionine aminopeptidase 1D, mitochondrial

EC number:EC:3.4.11.18

Alternative names:(MAP 1D) (MetAP 1D) (Methionyl aminopeptidase type 1D, mitochondrial) (Peptidase M 1D)

Cleaved into:

GeneID:254042

Gene names  (primary ):METAP1D

Gene names  (synonym ):MAP1D

Gene names  (ORF ):

Length:335

Mass:37088

Sequence:MAAPSGVHLLVRRGSHRIFSSPLNHIYLHKQSSSQQRRNFFFRRQRDISHSIVLPAAVSSAHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHANDSDLPMEEGMAFTIEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEA

Tissue specificity:Overexpressed in colon cancer cell lines and colon tumors as compared to normal tissues (at protein level). {ECO:0000269|PubMed:16568094}.

Induction:

Developmental stage:

Protein families:Peptidase M24A family, Methionine aminopeptidase type 1 subfamily


   💬 WhatsApp