MAAI_HUMAN   O43708


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O43708

Recommended name:Maleylacetoacetate isomerase

EC number:EC:5.2.1.2

Alternative names:(MAAI) (GSTZ1-1) (Glutathione S-transferase zeta 1)

Cleaved into:

GeneID:2954

Gene names  (primary ):GSTZ1

Gene names  (synonym ):MAAI

Gene names  (ORF ):

Length:216

Mass:24212

Sequence:MQAGKPILYSYFRSSCSWRVRIALALKGIDYKTVPINLIKDRGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA

Tissue specificity:Mostly expressed in liver followed by kidney, skeletal muscle and brain. Also expressed in melanocytes, synovium, placenta, breast and fetal liver and heart.

Induction:

Developmental stage:

Protein families:GST superfamily, Zeta family


   💬 WhatsApp