CC4L_HUMAN   Q8NHW4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8NHW4

Recommended name:C-C motif chemokine 4-like

EC number:

Alternative names:(Lymphocyte activation gene 1 protein) (LAG-1) (Macrophage inflammatory protein 1-beta) (MIP-1-beta) (Monocyte adherence-induced protein 5-alpha) (Small-inducible cytokine A4-like)

Cleaved into:

GeneID:388372

Gene names  (primary ):CCL4L1; CCL4L2

Gene names  (synonym ):CCL4L LAG1 SCYA4L1; CCL4L SCYA4L2

Gene names  (ORF ):;

Length:92

Mass:10166

Sequence:MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN

Tissue specificity:Detected in B-cells. {ECO:0000269|PubMed:14673550}.

Induction:

Developmental stage:

Protein families:Intercrine beta (chemokine CC) family


   💬 WhatsApp