RM51_HUMAN   Q4U2R6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q4U2R6

Recommended name:39S ribosomal protein L51, mitochondrial

EC number:

Alternative names:(L51mt) (MRP-L51) (Mitochondrial large ribosomal subunit protein mL51) (bMRP-64) (bMRP64)

Cleaved into:

GeneID:51258

Gene names  (primary ):MRPL51

Gene names  (synonym ):MRP64

Gene names  (ORF ):CDA09 HSPC241

Length:128

Mass:15095

Sequence:MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR

Tissue specificity:

Induction:

Developmental stage:

Protein families:Mitochondrion-specific ribosomal protein mL51 family


   💬 WhatsApp