KCP3_HUMAN   Q53RY4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q53RY4

Recommended name:Keratinocyte-associated protein 3

EC number:

Alternative names:(KCP-3)

Cleaved into:

GeneID:200634

Gene names  (primary ):KRTCAP3

Gene names  (synonym ):KCP3

Gene names  (ORF ):UNQ3066/PRO9898

Length:240

Mass:25627

Sequence:MRRCSLCAFDAARGPRRLMRVGLALILVGHVNLLLGAVLHGTVLRHVANPRGAVTPEYTVANVISVGSGLLSVSVGLVALLASRNLLRPPLHWVLLALALVNLLLSVACSLGLLLAVSLTVANGGRRLIADCHPGLLDPLVPLDEGPGHTDCPFDPTRIYDTALALWIPSLLMSAGEAALSGYCCVAALTLRGVGPCRKDGLQGQLEEMTELESPKCKRQENEQLLDQNQEIRASQRSWV

Tissue specificity:Expressed in skin, pancreas and keratinocytes. {ECO:0000269|PubMed:12752121}.

Induction:

Developmental stage:

Protein families:TMEM54 family


   💬 WhatsApp