TFF3_HUMAN Q07654
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q07654
Recommended name：Trefoil factor 3
EC number：
Alternative names：(Intestinal trefoil factor) (hITF) (Polypeptide P1.B) (hP1.B)
Cleaved into：
GeneID：7033
Gene names (primary )：TFF3
Gene names (synonym )：ITF TFI
Gene names (ORF )：
Length：94
Mass：10181
Sequence：MKRVLSCVPEPTVVMAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
Tissue specificity：Expressed in goblet cells of the intestines and colon (at protein level). Expressed by goblet cells of small and large intestinal epithelia and also by the uterus. Also expressed in the hypothalamus where it is detected in paraventricular, periventricular and supraoptic nuclei (at protein level). {ECO:0000269|PubMed:8346203, ECO:0000269|PubMed:8454642}.
Induction：
Developmental stage：
Protein families：