ID2B_HUMAN   Q14602


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q14602

Recommended name:Putative DNA-binding protein inhibitor ID-2B

EC number:

Alternative names:(Inhibitor of DNA binding 2B)

Cleaved into:

GeneID:

Gene names  (primary ):ID2B

Gene names  (synonym ):

Gene names  (ORF ):

Length:36

Mass:4055

Sequence:MKAFSPVRSIRKNSLLDHRLGISQSKTPVDDLMSLL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp