HV330_HUMAN P01768
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P01768
Recommended name:Immunoglobulin heavy variable 3-30
EC number:
Alternative names:(Ig heavy chain V-III region BUR) (Ig heavy chain V-III region CAM) (Ig heavy chain V-III region GA) (Ig heavy chain V-III region NIE)
Cleaved into:
GeneID:
Gene names (primary ):IGHV3-30
Gene names (synonym ):
Gene names (ORF ):
Length:117
Mass:12947
Sequence:MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
Tissue specificity:
Induction:
Developmental stage:
Protein families: