HSPB9_HUMAN   Q9BQS6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BQS6

Recommended name:Heat shock protein beta-9

EC number:

Alternative names:(HspB9) (Cancer/testis antigen 51) (CT51)

Cleaved into:

GeneID:94086

Gene names  (primary ):HSPB9

Gene names  (synonym ):

Gene names  (ORF ):

Length:159

Mass:17486

Sequence:MQRVGNTFSNESRVASRCPSVGLAERNRVATMPVRLLRDSPAAQEDNDHARDGFQMKLDAHGFAPEELVVQVDGQWLMVTGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQCVALALPEAQTGPSPRLGSLGSKASNLTR

Tissue specificity:Testis specific. {ECO:0000269|PubMed:11470154}.

Induction:

Developmental stage:

Protein families:Small heat shock protein (HSP20) family


   💬 WhatsApp