LAT1N_HUMAN   Q8MH63


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8MH63

Recommended name:Putative L-type amino acid transporter 1-like protein MLAS

EC number:

Alternative names:(hLAT1 3-transmembrane protein MLAS) (hLAT1 3TM MLAS)

Cleaved into:

GeneID:

Gene names  (primary ):SLC7A5P1

Gene names  (synonym ):MLAS

Gene names  (ORF ):

Length:180

Mass:18779

Sequence:MAGAGPKRRALAAPVAEEKEEAREKMLASKRADGAAPAGEGEGVTLQRNITLLNGVAIIVGAIIGSGIFVTPTGVLKEAGSPGLALVMWAACGVFSIVGALCYAELGTTISKSGGDYAYMLDVYGSLPAFLKLWIELLVIRPSSQYIVALVFATYLLKPLFPSCPVPEEAAKLMACHCVH

Tissue specificity:Expressed in peripheral blood mononuclear cells and lymphoid and myeloid cell lines. {ECO:0000269|PubMed:12009310}.

Induction:

Developmental stage:

Protein families:Amino acid-polyamine-organocation (APC) superfamily, L-type amino acid transporter (LAT) (TC 2.A.3.8) family


   💬 WhatsApp