H2A1D_HUMAN P20671
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P20671
Recommended name：Histone H2A type 1-D
EC number：
Alternative names：(Histone H2A.3) (Histone H2A/g)
Cleaved into：
GeneID：3013
Gene names (primary )：H2AC7
Gene names (synonym )：H2AFG HIST1H2AD
Gene names (ORF )：
Length：130
Mass：14107
Sequence：MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
Tissue specificity：
Induction：
Developmental stage：
Protein families：Histone H2A family