KR124_HUMAN P60329
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P60329
Recommended name:Keratin-associated protein 12-4
EC number:
Alternative names:(High sulfur keratin-associated protein 12.4) (Keratin-associated protein 12.4)
Cleaved into:
GeneID:386684
Gene names (primary ):KRTAP12-4
Gene names (synonym ):KAP12.4 KRTAP12.4
Gene names (ORF ):
Length:112
Mass:11433
Sequence:MCHTSHSSGCPMACPGSPCCVPSTCYPPEGYGTSCCCSAPCVALLCRPLCGVSTCCQPACCVPSPCQVACCVPVSCKPVLCVASFCPTSGCCQPFCPTLVYRPVTWSTPTGC
Tissue specificity:Restricted to a narrow region of the hair fiber cuticle, lying approximately 20 cell layers above the apex of the dermal papilla of the hair root; not detected in any other tissues. {ECO:0000269|PubMed:14962103, ECO:0000269|PubMed:15028290}.
Induction:
Developmental stage:
Protein families:KRTAP type 12 family