ISK13_HUMAN   Q1W4C9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q1W4C9

Recommended name:Serine protease inhibitor Kazal-type 13

EC number:

Alternative names:(Hepatitis B virus DNA polymerase transactivated serine protease inhibitor) (Hespintor) (Serine protease inhibitor Kazal-type 5-like 3)

Cleaved into:

GeneID:153218

Gene names  (primary ):SPINK13

Gene names  (synonym ):HBVDNAPTP1 SPINK5L3

Gene names  (ORF ):

Length:94

Mass:11051

Sequence:MAAFPHKIIFFLVCSTLTHVAFSGIFNKRDFTRWPKPRCKMYIPLDPDYNADCPNVTAPVCASNGHTFQNECFFCVEQREFHYRIKFEKYGKCD

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp