HS905_HUMAN   Q58FG0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q58FG0

Recommended name:Putative heat shock protein HSP 90-alpha A5

EC number:

Alternative names:(Heat shock protein 90-alpha E) (Heat shock protein 90Ae)

Cleaved into:

GeneID:

Gene names  (primary ):HSP90AA5P

Gene names  (synonym ):HSP90AE

Gene names  (ORF ):

Length:334

Mass:38738

Sequence:MGFHHVGQAGLELLTSGHPALERRPEYLEERRIKEIVKKHSQFIGYPITLFVEKKRNKQVSDAEAEKKEDKRKKKKESNDKPEIEDVGSDEEEEKKDADKKKKKSKEKYIDQELNKTKPIWTRNPDAITNEEYGEFHQSLTNNWEDHLAVKHFSVEGQLEELKDSRRVMKANQKHIYYITGETKDQVANSAFVECLQKHGLEVIYMIELIDKYCVQQLKELESKTVVSVAKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDMLEKKVKKVVVSNCMEDPQRHTNKIYRMIKLGLGVDEYDPTANDINAAITKEMPPLRGGDDTSRMEEVGGSG

Tissue specificity:

Induction:

Developmental stage:

Protein families:Heat shock protein 90 family


   💬 WhatsApp