H2A1A_HUMAN   Q96QV6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96QV6

Recommended name:Histone H2A type 1-A

EC number:

Alternative names:(H2A-clustered histone 1) (Histone H2A/r)

Cleaved into:

GeneID:221613

Gene names  (primary ):H2AC1

Gene names  (synonym ):H2AFR HIST1H2AA

Gene names  (ORF ):

Length:131

Mass:14234

Sequence:MSGRGKQGGKARAKSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHHHKAQSK

Tissue specificity:

Induction:

Developmental stage:

Protein families:Histone H2A family


   💬 WhatsApp