H2AJ_HUMAN   Q9BTM1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BTM1

Recommended name:Histone H2A.J

EC number:

Alternative names:(H2a/j)

Cleaved into:

GeneID:55766

Gene names  (primary ):H2AJ

Gene names  (synonym ):H2AFJ

Gene names  (ORF ):

Length:129

Mass:14019

Sequence:MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK

Tissue specificity:

Induction:

Developmental stage:

Protein families:Histone H2A family


   💬 WhatsApp