GSTO2_HUMAN   Q9H4Y5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H4Y5

Recommended name:Glutathione S-transferase omega-2

EC number:EC:2.5.1.18

Alternative names:(GSTO-2) (Glutathione S-transferase omega 2-2) (GSTO 2-2) (Glutathione-dependent dehydroascorbate reductase) (Monomethylarsonic acid reductase) (MMA(V) reductase)

Cleaved into:

GeneID:119391

Gene names  (primary ):GSTO2

Gene names  (synonym ):

Gene names  (ORF ):

Length:243

Mass:28254

Sequence:MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC

Tissue specificity:Expressed in a range of tissues, including the liver, kidney, skeletal muscle and prostate. Strongest expression in the testis. {ECO:0000269|PubMed:12618591}.

Induction:

Developmental stage:

Protein families:GST superfamily, Omega family


   💬 WhatsApp