GTR14_HUMAN   Q8TDB8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8TDB8

Recommended name:Solute carrier family 2, facilitated glucose transporter member 14

EC number:

Alternative names:(Glucose transporter type 14) (GLUT-14)

Cleaved into:

GeneID:144195

Gene names  (primary ):SLC2A14

Gene names  (synonym ):GLUT14

Gene names  (ORF ):

Length:520

Mass:56320

Sequence:MEFHNGGHVSGIGGFLVSLTSRMKPHTLAVTPALIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTLTDKANAPPSEVLLTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQQPIYATISAGVVNTIFTLLSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKNHYNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDGVMGMNSIEPAKETTTNV

Tissue specificity:Mainly expressed in testis (PubMed:12504846, PubMed:27460888). Also expressed in small intestine, liver and kidney (PubMed:27460888). {ECO:0000269|PubMed:12504846, ECO:0000269|PubMed:27460888}.

Induction:

Developmental stage:

Protein families:Major facilitator superfamily, Sugar transporter (TC 2.A.1.1) family, Glucose transporter subfamily


   💬 WhatsApp