TF2H5_HUMAN   Q6ZYL4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6ZYL4

Recommended name:General transcription factor IIH subunit 5

EC number:

Alternative names:(General transcription factor IIH polypeptide 5) (TFB5 ortholog) (TFIIH basal transcription factor complex TTD-A subunit)

Cleaved into:

GeneID:404672

Gene names  (primary ):GTF2H5

Gene names  (synonym ):C6orf175 TTDA

Gene names  (ORF ):

Length:71

Mass:8053

Sequence:MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK

Tissue specificity:

Induction:

Developmental stage:

Protein families:TFB5 family


   💬 WhatsApp