TUSC2_HUMAN O75896
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O75896
Recommended name：Tumor suppressor candidate 2
EC number：
Alternative names：(Fusion 1 protein) (Fus-1 protein) (PDGFA-associated protein 2)
Cleaved into：
GeneID：11334
Gene names (primary )：TUSC2
Gene names (synonym )：C3orf11 FUS1 LGCC PDAP2
Gene names (ORF )：
Length：110
Mass：12074
Sequence：MGASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV
Tissue specificity：Strong expression in heart, lung, skeletal muscle, kidney, and pancreas, followed by brain and liver, lowest levels in placenta.
Induction：
Developmental stage：
Protein families：TUSC2 family