T10B_HUMAN Q9Y5J6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Y5J6
Recommended name：Mitochondrial import inner membrane translocase subunit Tim10 B
EC number：
Alternative names：(Fracture callus protein 1) (FxC1) (Mitochondrial import inner membrane translocase subunit Tim9 B) (TIMM10B) (Tim10b)
Cleaved into：
GeneID：26515
Gene names (primary )：TIMM10B
Gene names (synonym )：FXC1 TIM9B TIMM9B
Gene names (ORF )：
Length：103
Mass：11586
Sequence：MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS
Tissue specificity：Ubiquitous, with highest expression in heart, kidney, liver and skeletal muscle. {ECO:0000269|PubMed:10611480, ECO:0000269|PubMed:14726512}.
Induction：
Developmental stage：
Protein families：Small Tim family