FDSCP_HUMAN Q8NFU4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8NFU4
Recommended name：Follicular dendritic cell secreted peptide
EC number：
Alternative names：(FDC secreted protein) (FDC-SP)
Cleaved into：
GeneID：260436
Gene names (primary )：FDCSP
Gene names (synonym )：C4orf7
Gene names (ORF )：UNQ733/PRO1419
Length：85
Mass：9700
Sequence：MKKVLLLITAILAVAVGFPVSQDQEREKRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPLPSEK
Tissue specificity：Abundantly expressed in tonsil, lymph node, and trachea; strong expression in prostate; lower expression in thyroid, stomach, and colon. {ECO:0000269|PubMed:12193705}.
Induction：
Developmental stage：
Protein families：