TIMP1_HUMAN P01033
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P01033
Recommended name：Metalloproteinase inhibitor 1
EC number：
Alternative names：(Erythroid-potentiating activity) (EPA) (Fibroblast collagenase inhibitor) (Collagenase inhibitor) (Tissue inhibitor of metalloproteinases 1) (TIMP-1)
Cleaved into：
GeneID：7076
Gene names (primary )：TIMP1
Gene names (synonym )：CLGI TIMP
Gene names (ORF )：
Length：207
Mass：23171
Sequence：MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
Tissue specificity：Detected in rheumatoid synovial fluid (at protein level). {ECO:0000269|PubMed:1730286}.
Induction：
Developmental stage：
Protein families：Protease inhibitor I35 (TIMP) family