FABP5_HUMAN Q01469
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q01469
Recommended name：Fatty acid-binding protein 5
EC number：
Alternative names：(Epidermal-type fatty acid-binding protein) (E-FABP) (Fatty acid-binding protein, epidermal) (Psoriasis-associated fatty acid-binding protein homolog) (PA-FABP)
Cleaved into：
GeneID：2171
Gene names (primary )：FABP5
Gene names (synonym )：
Gene names (ORF )：
Length：135
Mass：15164
Sequence：MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
Tissue specificity：Keratinocytes; highly expressed in psoriatic skin (PubMed:8092987). Expressed in brain gray matter (PubMed:21395585). {ECO:0000269|PubMed:21395585, ECO:0000269|PubMed:8092987}.
Induction：
Developmental stage：
Protein families：Calycin superfamily, Fatty-acid binding protein (FABP) family