IF5A2_HUMAN Q9GZV4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9GZV4
Recommended name:Eukaryotic translation initiation factor 5A-2
EC number:
Alternative names:(eIF-5A-2) (eIF-5A2) (Eukaryotic initiation factor 5A isoform 2)
Cleaved into:
GeneID:56648
Gene names (primary ):EIF5A2
Gene names (synonym ):
Gene names (ORF ):
Length:153
Mass:16793
Sequence:MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
Tissue specificity:Expressed in ovarian and colorectal cancer cell lines (at protein level). Highly expressed in testis. Overexpressed in some cancer cells. {ECO:0000269|PubMed:11161802, ECO:0000269|PubMed:16519677}.
Induction:
Developmental stage:
Protein families:EIF-5A family