DCTN5_HUMAN   Q9BTE1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BTE1

Recommended name:Dynactin subunit 5

EC number:

Alternative names:(Dynactin subunit p25)

Cleaved into:

GeneID:84516

Gene names  (primary ):DCTN5

Gene names  (synonym ):

Gene names  (ORF ):

Length:182

Mass:20127

Sequence:MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV

Tissue specificity:

Induction:

Developmental stage:

Protein families:Dynactin subunits 5/6 family, Dynactin subunit 5 subfamily


   💬 WhatsApp