DOXA1_HUMAN   Q1HG43


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q1HG43

Recommended name:Dual oxidase maturation factor 1

EC number:

Alternative names:(Dual oxidase activator 1) (Numb-interacting protein)

Cleaved into:

GeneID:90527

Gene names  (primary ):DUOXA1

Gene names  (synonym ):NIP NUMBIP

Gene names  (ORF ):

Length:343

Mass:37815

Sequence:MATLGHTFPFYAGPKPTFPMDTTLASIIMIFLTALATFIVILPGIRGKTRLFWLLRVVTSLFIGAAILAVNFSSEWSVGQVSTNTSYKAFSSEWISADIGLQVGLGGVNITLTGTPVQQLNETINYNEEFTWRLGENYAEEYAKALEKGLPDPVLYLAEKFTPRSPCGLYRQYRLAGHYTSAMLWVAFLCWLLANVMLSMPVLVYGGYMLLATGIFQLLALLFFSMATSLTSPCPLHLGASVLHTHHGPAFWITLTTGLLCVLLGLAMAVAHRMQPHRLKAFFNQSVDEDPMLEWSPEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYCKEAHPKDPDCAL

Tissue specificity:Specifically expressed in thyroid gland. Also detected in esophagus. {ECO:0000269|PubMed:16651268}.

Induction:

Developmental stage:

Protein families:DUOXA family


   💬 WhatsApp