DSCR6_HUMAN   P57055


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P57055

Recommended name:Protein ripply3

EC number:

Alternative names:(Down syndrome critical region protein 6)

Cleaved into:

GeneID:53820

Gene names  (primary ):RIPPLY3

Gene names  (synonym ):DSCR6

Gene names  (ORF ):

Length:190

Mass:20368

Sequence:MEPEAAAGARKARGRGCHCPGDAPWRPPPPRGPESPAPWRPWIQTPGDAELTRTGRPLEPRADQHTFGSKGAFGFQHPVRVYLPMSKRQEYLRSSGEQVLASFPVQATIDFYDDESTESASEAEEPEEGPPPLHLLPQEVGGRQENGPGGKGRDQGINQGQRSSGGGDHWGEGPLPQGVSSRGGKCSSSK

Tissue specificity:Expressed at a low level in fetal kidney and fetal brain. {ECO:0000269|PubMed:10814524}.

Induction:

Developmental stage:

Protein families:Ripply family


   💬 WhatsApp