TYOBP_HUMAN O43914
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O43914
Recommended name：TYRO protein tyrosine kinase-binding protein
EC number：
Alternative names：(DNAX-activation protein 12) (Killer-activating receptor-associated protein) (KAR-associated protein)
Cleaved into：
GeneID：7305
Gene names (primary )：TYROBP
Gene names (synonym )：DAP12 KARAP
Gene names (ORF )：
Length：113
Mass：12179
Sequence：MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK
Tissue specificity：Expressed at low levels in the early development of the hematopoietic system and in the promonocytic stage and at high levels in mature monocytes. Expressed in hematological cells and tissues such as peripheral blood leukocytes and spleen. Also found in bone marrow, lymph nodes, placenta, lung and liver. Expressed at lower levels in different parts of the brain especially in the basal ganglia and corpus callosum. {ECO:0000269|PubMed:11922939}.
Induction：
Developmental stage：
Protein families：TYROBP family