NUD11_HUMAN Q96G61
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96G61
Recommended name：Diphosphoinositol polyphosphate phosphohydrolase 3-beta
EC number：EC:3.6.1.52
Alternative names：(DIPP-3-beta) (DIPP3-beta) (hDIPP3beta) (Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 3-beta) (Diadenosine hexaphosphate hydrolase(AMP-forming)) (Nucleoside diphosphate-linked moiety X motif 11) (Nudix motif 11) (hAps1)
Cleaved into：
GeneID：55190
Gene names (primary )：NUDT11
Gene names (synonym )：APS1 DIPP3B
Gene names (ORF )：
Length：164
Mass：18559
Sequence：MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDRKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP
Tissue specificity：Mainly expressed in testis and, at lower level in brain. According to PubMed:12121577, it is also expressed in pancreas and weakly expressed in thymus, prostate, ovary, lung, small intestine and heart. {ECO:0000269|PubMed:12105228, ECO:0000269|PubMed:12121577}.
Induction：
Developmental stage：
Protein families：Nudix hydrolase family, DIPP subfamily